PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.7NG076000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family B3
Protein Properties Length: 528aa    MW: 59012.1 Da    PI: 9.9496
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.7NG076000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3352.5e-111432241398
                          TT-EE--HHH.HTT...---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                   B3  13 sgrlvlpkkfaeeh...ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                          +  + +p kf+++h   +  ++++ + ++  ++g+++++kl  + +++ +++t+GW++F   +++ e   ++ +++g++ f  +vkvf 
  Pavir.7NG076000.1.p 143 E-KMPIPAKFLQQHipkE--HQNNCMAIVLGPHGKVYNIKL--ETYRSDMFFTGGWSQFMVFHDITESNALLVRYEGNMVF--TVKVFG 224
                          3.489*********9643..445668999************..999999*******************************9..898886 PP

2B359.84.6e-19283367186
                          EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS.-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesg.rsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                          ++k+ ++ ++l+++ l l k f++++g++k++++tl+    +g +sW v    +k+s +y+l +GW++F+++n+LkegD+++F +++
  Pavir.7NG076000.1.p 283 WIKKQINTNTLEKH-LALAKAFCDAIGLQKPCTITLRTSRADGtKSWLVHGLTCKTS-SYLLVQGWRQFCQENHLKEGDTCTFNVIE 367
                          67888999999999.**************999777776666669*******666665.79***********************9765 PP

3B348.12.1e-15429511186
                          EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                          ++k+++++++ +++ l lp +f++++g  +++ +tl+  ++s +sW+  l+  ++ g+  l +GWk+F+ +ng+++gD+++ + ++
  Pavir.7NG076000.1.p 429 WVKKEINASTIENH-LNLPLPFCKAIGFRQRCMITLKTSTSSTKSWQACLNLYQNCGQ--LVGGWKSFCLDNGIRVGDVCTMEIIE 511
                          78999********9.***********99999999999999999*******88888877..789******************99765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508638.20510104IPR003340B3 DNA binding domain
SMARTSM010190.005813104IPR003340B3 DNA binding domain
SuperFamilySSF1019361.49E-923106IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.9E-923105IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.2E-15128226IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.75E-16129226IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.897130226IPR003340B3 DNA binding domain
CDDcd100171.09E-11131223No hitNo description
SMARTSM010194.4E-7133226IPR003340B3 DNA binding domain
PfamPF023627.3E-8142223IPR003340B3 DNA binding domain
SuperFamilySSF1019364.71E-17277378IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.9E-19278378IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.66282379IPR003340B3 DNA binding domain
SMARTSM010191.2E-6284379IPR003340B3 DNA binding domain
PfamPF023621.1E-14285367IPR003340B3 DNA binding domain
CDDcd100171.40E-9294363No hitNo description
SuperFamilySSF1019366.87E-16426522IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.292428523IPR003340B3 DNA binding domain
PfamPF023628.7E-12429511IPR003340B3 DNA binding domain
SMARTSM010192.4E-4430523IPR003340B3 DNA binding domain
CDDcd100175.73E-10431513No hitNo description
Gene3DG3DSA:2.40.330.101.3E-15432522IPR015300DNA-binding pseudobarrel domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 528 aa     Download sequence    Send to blast
MASSGDHAAA AKHLRVLLPF TCDSLRIPDE LAEEIGAEEA LVVGPMGGNG KVLWRVEVGR  60
DGNGAFLGRG WPELADACGV GAGWLLVLRH RGRGVLTVKA FDRTRCLRDL GAPAPSPAEA  120
AVSGKATARK PQFIIVLSTD FMEKMPIPAK FLQQHIPKEH QNNCMAIVLG PHGKVYNIKL  180
ETYRSDMFFT GGWSQFMVFH DITESNALLV RYEGNMVFTV KVFGTDGIPR DSKQKENRAQ  240
QRSTLPHSEK LQKAPSVSIQ KHKRKNKTSL GRNSIYKIGP PSWIKKQINT NTLEKHLALA  300
KAFCDAIGLQ KPCTITLRTS RADGTKSWLV HGLTCKTSSY LLVQGWRQFC QENHLKEGDT  360
CTFNVIETTL WNVLITRHEE KMNQFCYQET PKSKKNKSNT DGQKMLQGSM NYLNKSRTKS  420
VFEIGPPAWV KKEINASTIE NHLNLPLPFC KAIGFRQRCM ITLKTSTSST KSWQACLNLY  480
QNCGQLVGGW KSFCLDNGIR VGDVCTMEII ETTLWNVTVD RREDRTR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975298.11e-160PREDICTED: putative B3 domain-containing protein Os04g0347400 isoform X1
TrEMBLA0A0A9S1930.0A0A0A9S193_ARUDO; Uncharacterized protein
STRINGSi012530m1e-134(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.11e-17B3 family protein